pTH (1-34) amide (human) trifluoroacetate salt,CAS : 83139-29-1

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-NH₂ trifluoroacetate salt

Product description

pTH (1-34) amide (human) trifluoroacetate salt,CAS : 83139-29-1 from ruixi.It can be used in the study of osteoporosis and regenerative medicine.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	83139-29-1
Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH₂
Molecular Formula	C₁₈₁H₂₉₂N₅₆O₅₀S₂
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of pTH (1-34) amide (human) trifluoroacetate salt

Related Product

• biotinyl-pth-1-34-human-trifluoroacetate-salt